Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C5XMK9

dbSWEET id: dbswt_918

Accession:   C5XMK9

Uniprot status:   Unreviewed

Organism:   Sorghum bicolor

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Sorghinae ⇒ Sorghum.

Sequence Information back to top


Sequence length:   213

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMA           CVV:   411       CHI:   4

Fasta sequence:

>tr|C5XMK9|C5XMK9_SORBI|Unreviewed|Sorghum_bicolor|213
MVSDVVAFLGFLASFSLFASPAFIFRRIITEASVVGYPFLPYPMAFLNCMIWLFYGTVHT
NSDYVIIINSVGMIIEVIFMGFYIWFADGMDLRVALIELFGMGGLGTFVALLGYLWRDTV
FGYAGVVSGIIMYGSPLSVARRVFETRNVQNMSLLMALASLTASSVWTAYAFASKPYDFY
IAIPNLIGLVLALVQLALYAYYYFNGEEEDVVA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   204

Alignment file: C5XMK9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  C5XMK9_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    5.6% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  C5XMK9_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.5% favored    4.5% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  C5XMK9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    7.3% allowed    .0% week    1.1% disallowed

Gene Informationback to top


Gene ID:   8078749     Total Exons:   4     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur