Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C5XKE5

dbSWEET id: dbswt_544

Accession:   C5XKE5

Uniprot status:   Unreviewed

Organism:   Sorghum bicolor

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Sorghinae ⇒ Sorghum.

Sequence Information back to top


Sequence length:   259

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMS           CVV:   417       CHI:   1.4

Fasta sequence:

>tr|C5XKE5|C5XKE5_SORBI|Unreviewed|Sorghum_bicolor|259
MVPNTVRVAVGILGNAASMLLYAAPILTFRRVIKKGNVEEFSCVPYILALFNCLLYTWYG
LPVVSSGWENLPVATINGLGILLEITFIGIYIWFAPAEKKRFALQLVLPVLALFALTAAL
SSFMAHTHHMRKVFVGSVGLVASISMYSSPMVAAKRVIETKSVEFMPFYLSLFSFLSSAL
WMIYGLLGRDFFIASPNFIGVPMGMLQLLLYCIYRRDHGAAAEAEVRVHGAAADEEKGLK
AAVPMAVLVQPQETTDASK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   216

Alignment file: C5XKE5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  C5XKE5_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.0% favored    5.9% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  C5XKE5_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.1% favored    4.8% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  C5XKE5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.4% favored    7.4% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Gene ID:   8081388     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur