| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C5XHK1
dbSWEET id: dbswt_603
Accession: C5XHK1
Uniprot status: Unreviewed
Organism: Sorghum bicolor
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Sorghinae ⇒ Sorghum.
Sequence Information back to top
Sequence length: 231
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|C5XHK1|C5XHK1_SORBI|Unreviewed|Sorghum_bicolor|231
MSSLYDLSCFAAGLAGNVFALALFLSPVPTFKRVLKAKSTEQFDGLPYLLSLLNCCICLW
YGLPWVSGGGGRALVATVNGTGALFQLAYISLFIFYADSRTTRLRITGLLVLVVFAFALI
AHASIALFDQPVRQLFVGSVSMASLVSMFASPLAVMGLVIRTECVEFMPFYLSLSTFLMS
ASFAMYGLLLRDFFIYFPNGLGVVLGAMQLVLYAYYSRRWKNSGSSAALLA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 218
Alignment file: C5XHK1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: C5XHK1_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 3.2% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: C5XHK1_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.2% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: C5XHK1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.8% allowed 1.1% week .5% disallowed
Gene Informationback to top
Gene ID: 8059144 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA