Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : C5X597
dbSWEET id: dbswt_77
Accession: C5X597
Uniprot status: Unreviewed
Organism: Sorghum bicolor
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Sorghinae ⇒ Sorghum.
Sequence Information back to top
Sequence length: 273
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|C5X597|C5X597_SORBI|Unreviewed|Sorghum_bicolor|273
MAGGLFSMEHPWVSAFGILGNIISFLVFLAPVPTFLRVYRKKSTEGFSSVPYVVALFSCT
LWILYAVVKTNSSPLLTINAFGCVVEATYILLYLIYAPRAARLRALAFFFLLDVAALALI
VVVVVVLVAEPHRVKVLGSICLAFSMAVFVAPLSVIFVVIRTKSAEFMPFTLSFFLTLSA
VAWFLYGIFTKDPYVTLPNVGGFFFGCIQMVLYCCYRKPSASVVLPTTTDAAATEMELPL
AAHQAVAPVLAELQKLEEAMGSPRKHGGVVKVV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: C5X597.pir
Inward Open:
Template: 5CTG.pdb
Model structure: C5X597_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.8% allowed 1.6% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: C5X597_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.8% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: C5X597_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.8% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 8054794 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA