| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C5X0L3
dbSWEET id: dbswt_328
Accession: C5X0L3
Uniprot status: Unreviewed
Organism: Sorghum bicolor
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Sorghinae ⇒ Sorghum.
Sequence Information back to top
Sequence length: 313
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|C5X0L3|C5X0L3_SORBI|Unreviewed|Sorghum_bicolor|313
MITVGHPVVFAVGILGNILSFLVTLAPVPTFYRVYKKKSTESFQSVPYVVALLSAMLWLY
YALLSIDVLLLSINTIACVVESVYLAIYLTYAPKPAMAFTLKLLFTMNMGLFGAMVAFLQ
FYVDGQRRVSIAGGVGAAFALAVFVAPLTIIRQVIRTKSVEYMPFWLSFFLTISAVVWFF
YGLLMKDFFVAMPNVLGLLFGLAQMALYFVYRNRNPKQNGAVSEMQQQAAVVQADADAKK
EQQLRQAHADAGADGEAVAVRIDDEEEPKNVVVDIMPPPPPLLPAERASPPLPLPPPPAM
VMMTAHQTAVEVV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 2 Model end: 213
Alignment file: C5X0L3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: C5X0L3_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.3% allowed .5% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: C5X0L3_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.1% favored 4.8% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: C5X0L3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.3% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 8082659 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number




Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0032588 - trans-Golgi network membrane
GO:0012506 - vesicle membrane
GO:0008515 - sucrose transmembrane transporter activity
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
GO:0071836 - nectar secretion
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA