Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C5RAS1

dbSWEET id: dbswt_2001

Accession:   C5RAS1

Uniprot status:   Unreviewed

Organism:   Weissella paramesenteroides

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Weissella.

Sequence Information back to top


Sequence length:   105

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   SDSD           CVV:   328       CHI:   -8.6

Fasta sequence:

>tr|C5RAS1|C5RAS1_WEIPA|Unreviewed|Weissella paramesenteroides| 105
MDSGTDKSSDRRRFIDVSSRVTIVRLISILATIMCVLMYLSYITEIQSNLAGNPVPLVQP
LTMMLDAVLWTGYGWLKKYRDWPLVISNVPGVFLGIATIITIYVH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   28     Model end:   104

Inward Open:

Template:   4X5M.pdb

Model structure:  C5RAS1_inward.pdb    Alignment file: C5RAS1_inw.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    5.5% allowed    2.3% week    1.6% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C5RAS1_outward.pdb    Alignment file: C5RAS1_out.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    7.8% allowed    1.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C5RAS1_occluded.pdb    Alignment file: C5RAS1_occ.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    6.2% allowed    1.6% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur