Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C4WVJ1

dbSWEET id: dbswt_1146

Accession:   C4WVJ1

Uniprot status:   Unreviewed

Organism:   Acyrthosiphon pisum

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Sternorrhyncha ⇒ Aphidiformes ⇒ Aphidoidea ⇒ Aphididae ⇒ Macrosiphini ⇒ Acyrthosiphon.

Sequence Information back to top


Sequence length:   220

Substrate Binding Site:   SHWC           CVV:   440       CHI:   -2.4

Selectivity Filter:   MRLL           CVV:   520       CHI:   5

Fasta sequence:

>tr|C4WVJ1|C4WVJ1_ACYPI|Unreviewed|Acyrthosiphon_pisum|220
MDLYEVYIKAVSFSAGCASTAMMLTPLLVCKDIVKKKTSDHVNLSTFVGALFRSSLFFRQ
GFILNLQTVMFVHGMGLLINTLYLALYWYYSNKKMNVITTLFKTTLLSSVLLTYSFIEST
DLVVTRFPIMVSIIHLSLIGWPLLSVRETIKTKKWSGHPKPILINSIVLCILWLLYSINI
GNIIIFTQCSVAFIFSSAQLGLWAIYPEEKNQRDKMEKHE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: C4WVJ1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  C4WVJ1_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    7.9% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  C4WVJ1_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.6% favored    6.3% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  C4WVJ1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.3% allowed    .5% week    .0% disallowed

Gene Informationback to top


Gene ID:   100168117     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur