Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : C4WVJ1
dbSWEET id: dbswt_1146
Accession: C4WVJ1
Uniprot status: Unreviewed
Organism: Acyrthosiphon pisum
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Paraneoptera ⇒ Hemiptera ⇒ Sternorrhyncha ⇒ Aphidiformes ⇒ Aphidoidea ⇒ Aphididae ⇒ Macrosiphini ⇒ Acyrthosiphon.
Sequence Information back to top
Sequence length: 220
Substrate Binding Site: SHWC CVV: 440 CHI: -2.4
Selectivity Filter: MRLL CVV: 520 CHI: 5
Fasta sequence:
>tr|C4WVJ1|C4WVJ1_ACYPI|Unreviewed|Acyrthosiphon_pisum|220
MDLYEVYIKAVSFSAGCASTAMMLTPLLVCKDIVKKKTSDHVNLSTFVGALFRSSLFFRQ
GFILNLQTVMFVHGMGLLINTLYLALYWYYSNKKMNVITTLFKTTLLSSVLLTYSFIEST
DLVVTRFPIMVSIIHLSLIGWPLLSVRETIKTKKWSGHPKPILINSIVLCILWLLYSINI
GNIIIFTQCSVAFIFSSAQLGLWAIYPEEKNQRDKMEKHE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: C4WVJ1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: C4WVJ1_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 7.9% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: C4WVJ1_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 6.3% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: C4WVJ1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 7.3% allowed .5% week .0% disallowed
Gene Informationback to top
Gene ID: 100168117 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5