Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C4V1A2

dbSWEET id: dbswt_1657

Accession:   C4V1A2

Uniprot status:   Unreviewed

Organism:   Selenomonas flueggei

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Selenomonadales ⇒ Selenomonadaceae ⇒ Selenomonas.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   TSTS           CVV:   332       CHI:   -3

Fasta sequence:

>tr|C4V1A2|C4V1A2_9FIRM|Unreviewed|Selenomonas flueggei|87
MKKKKINLIVGSIGAFIGVFVFITYIPQIIANLEGVKAQPWQPLTASISCLIWVIYGWTK
EPKKDFILIVPNLIGVILGFLTFVTAI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  C4V1A2_inward.pdb    Alignment file: C4V1A2_inw.pir

Procheck score ⇒ Ramachandran plot: 93.0% favored    5.5% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C4V1A2_outward.pdb    Alignment file: C4V1A2_out.pir

Procheck score ⇒ Ramachandran plot: 92.2% favored    5.5% allowed    .8% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C4V1A2_occluded.pdb    Alignment file: C4V1A2_occ.pir

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.8% allowed    .8% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur