Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C4K2K0

dbSWEET id: dbswt_2000

Accession:   C4K2K0

Uniprot status:   Unreviewed

Organism:   Rickettsia peacockii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rickettsiales ⇒ Rickettsiaceae ⇒ Rickettsieae ⇒ Rickettsia ⇒ spotted fever group.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   LNLN           CVV:   440       CHI:   0.6

Selectivity Filter:   MAMA           CVV:   382       CHI:   7.4

Fasta sequence:

>tr|C4K2K0|C4K2K0_RICPU|Unreviewed|Rickettsia peacockii|87
MSPKMTFYEKYMTIVGTIGNFMFYVQAHKIFTCQSSASVSMPTFTISAIALCSWLIYGIL
IKNTPIIIANIVGFIGALLVLLTIIIY

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  C4K2K0_inward.pdb    Alignment file: C4K2K0_inw.pir

Procheck score ⇒ Ramachandran plot: 94.0% favored    5.2% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C4K2K0_outward.pdb    Alignment file: C4K2K0_out.pir

Procheck score ⇒ Ramachandran plot: 94.8% favored    4.5% allowed    .0% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C4K2K0_occluded.pdb    Alignment file: C4K2K0_occ.pir

Procheck score ⇒ Ramachandran plot: 97.0% favored    2.2% allowed    .7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur