Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C4GM29

dbSWEET id: dbswt_1656

Accession:   C4GM29

Uniprot status:   Unreviewed

Organism:   Kingella oralis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Kingella.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|C4GM29|C4GM29_9NEIS|Unreviewed|Kingella oralis|88
MTEKQMKILSVVAALTAVGMYVSYIPQIRNNLNGQPGDWLQPLVAAVNCTLWVAYGLLKK
QRDWPVVLANAPGIFLGLITFVTSIVKF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  C4GM29_inward.pdb    Alignment file: C4GM29_inw.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    7.1% allowed    3.2% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C4GM29_outward.pdb    Alignment file: C4GM29_out.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.1% allowed    .0% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C4GM29_occluded.pdb    Alignment file: C4GM29_occ.pir

Procheck score ⇒ Ramachandran plot: 94.4% favored    3.2% allowed    .8% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur