| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C4GJ43
dbSWEET id: dbswt_1655
Accession: C4GJ43
Uniprot status: Unreviewed
Organism: Kingella oralis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Betaproteobacteria ⇒ Neisseriales ⇒ Neisseriaceae ⇒ Kingella.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|C4GJ43|C4GJ43_9NEIS|Unreviewed|Kingella oralis|88
MISKAKFNTFVGSIGAAMGIFVFVAYIPQIIANMQGAKAQPWQPLFAAASCLIWVLYGWS
KEPRKDWILIIPNAVGVILGFLTFLTSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: C4GJ43_inward.pdb Alignment file: C4GJ43_inw.pir Procheck score ⇒ Ramachandran plot: 88.3% favored 9.4% allowed 2.3% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: C4GJ43_outward.pdb Alignment file: C4GJ43_out.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 5.5% allowed .0% week .8% disallowed Occluded: Model structure: C4GJ43_occluded.pdb Alignment file: C4GJ43_occ.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 8.6% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA