Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : C4FPG4
dbSWEET id: dbswt_1653
Accession: C4FPG4
Uniprot status: Unreviewed
Organism: Veillonella dispar
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Veillonellales ⇒ Veillonellaceae ⇒ Veillonella.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|C4FPG4|C4FPG4_9FIRM|Unreviewed|Veillonella dispar|87
MTKERFNMLVGSIGAFIGVFVFLAYIPQIIANLHGQPSQPWQPLFAAVSCLIWVLYGWTK
SPKRDYILIVPNLAGVILGTLTFLTSF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: C4FPG4_inward.pdb Alignment file: C4FPG4_inw.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 4.8% allowed .8% week 2.4% disallowed Outward Open: Template: 4X5N.pdb Model structure: C4FPG4_outward.pdb Alignment file: C4FPG4_out.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 4.0% allowed 1.6% week .8% disallowed Occluded: Model structure: C4FPG4_occluded.pdb Alignment file: C4FPG4_occ.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 9.5% allowed 2.4% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA