Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C4FPG4

dbSWEET id: dbswt_1653

Accession:   C4FPG4

Uniprot status:   Unreviewed

Organism:   Veillonella dispar

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Veillonellales ⇒ Veillonellaceae ⇒ Veillonella.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|C4FPG4|C4FPG4_9FIRM|Unreviewed|Veillonella dispar|87
MTKERFNMLVGSIGAFIGVFVFLAYIPQIIANLHGQPSQPWQPLFAAVSCLIWVLYGWTK
SPKRDYILIVPNLAGVILGTLTFLTSF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  C4FPG4_inward.pdb    Alignment file: C4FPG4_inw.pir

Procheck score ⇒ Ramachandran plot: 92.1% favored    4.8% allowed    .8% week    2.4% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C4FPG4_outward.pdb    Alignment file: C4FPG4_out.pir

Procheck score ⇒ Ramachandran plot: 93.7% favored    4.0% allowed    1.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C4FPG4_occluded.pdb    Alignment file: C4FPG4_occ.pir

Procheck score ⇒ Ramachandran plot: 88.1% favored    9.5% allowed    2.4% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur