Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : C3Y1V0
dbSWEET id: dbswt_1143
Accession: C3Y1V0
Uniprot status: Unreviewed
Organism: Branchiostoma floridae
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Cephalochordata ⇒ Branchiostomidae ⇒ Branchiostoma.
Sequence Information back to top
Sequence length: 210
Substrate Binding Site: NNWN CVV: 451 CHI: -11.4
Selectivity Filter: MNMA CVV: 411 CHI: 2.1
Fasta sequence:
>tr|C3Y1V0|C3Y1V0_BRAFL|Unreviewed|Branchiostoma_floridae|210
MEEIKVVSTVCLVFTLCMFSAGIPDCLKMWRTRSTQNIPFLPFLVTCINNLIWLYYGLWQ
QDSTLIIVNAVGAVLQSICMFTYMVASKQKSRPMSQILVGVVVLTTLYLYLTIVITSPTV
LVDRLGLAGAGITMLMYTSPMMELVTVVRTKSTRSISRPLTVATFFASSLWFYYGYLLQD
LYVQVPNLPGIISSIVRLYLFWRYPGEKLA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 206
Alignment file: C3Y1V0.pir
Inward Open:
Template: 5CTG.pdb
Model structure: C3Y1V0_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 4.9% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: C3Y1V0_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.5% favored 5.4% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: C3Y1V0_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 6.5% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 7215536 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA