Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C3Y1V0

dbSWEET id: dbswt_1143

Accession:   C3Y1V0

Uniprot status:   Unreviewed

Organism:   Branchiostoma floridae

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Chordata ⇒ Cephalochordata ⇒ Branchiostomidae ⇒ Branchiostoma.

Sequence Information back to top


Sequence length:   210

Substrate Binding Site:   NNWN           CVV:   451       CHI:   -11.4

Selectivity Filter:   MNMA           CVV:   411       CHI:   2.1

Fasta sequence:

>tr|C3Y1V0|C3Y1V0_BRAFL|Unreviewed|Branchiostoma_floridae|210
MEEIKVVSTVCLVFTLCMFSAGIPDCLKMWRTRSTQNIPFLPFLVTCINNLIWLYYGLWQ
QDSTLIIVNAVGAVLQSICMFTYMVASKQKSRPMSQILVGVVVLTTLYLYLTIVITSPTV
LVDRLGLAGAGITMLMYTSPMMELVTVVRTKSTRSISRPLTVATFFASSLWFYYGYLLQD
LYVQVPNLPGIISSIVRLYLFWRYPGEKLA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: C3Y1V0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  C3Y1V0_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.9% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  C3Y1V0_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.4% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  C3Y1V0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    6.5% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Gene ID:   7215536     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur