Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : C3J865
dbSWEET id: dbswt_1651
Accession: C3J865
Uniprot status: Unreviewed
Organism: Porphyromonas endodontalis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Porphyromonadaceae ⇒ Porphyromonas.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C3J865|C3J865_POREA|Unreviewed|Porphyromonas endodontalis|86
MNQEKFLSILGWVATATAMAMYISYIPQIGSNLAGHKGDWLQPMVAGINCTLWVAYGFVR
KKKDWPIVIANLPGIVCGFLASFTAM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: C3J865_inward.pdb Alignment file: C3J865_inw.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 10.3% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: C3J865_outward.pdb Alignment file: C3J865_out.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 10.3% allowed .8% week 1.6% disallowed Occluded: Model structure: C3J865_occluded.pdb Alignment file: C3J865_occ.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.1% allowed .8% week 2.4% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA