Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C2KJS1

dbSWEET id: dbswt_1647

Accession:   C2KJS1

Uniprot status:   Unreviewed

Organism:   Leuconostoc mesenteroides

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.

Sequence Information back to top


Sequence length:   104

Substrate Binding Site:   ANAN           CVV:   326       CHI:   -3.4

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|C2KJS1|C2KJS1_LEUMC|Unreviewed|Leuconostoc mesenteroides| 104
MNYDNYVPKESRKEVSQERIRFLKLLSKVAVVFCCLMYISYIPQITANLSGNPVSVLQPL
CATVNATLWVTYGWLKTYKDWPVILANIPGVIFGVVTVVTVYVH

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   27     Model end:   103

Inward Open:

Template:   4X5M.pdb

Model structure:  C2KJS1_inward.pdb    Alignment file: C2KJS1_inw.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    8.5% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C2KJS1_outward.pdb    Alignment file: C2KJS1_out.pir

Procheck score ⇒ Ramachandran plot: 87.7% favored    10.8% allowed    1.5% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C2KJS1_occluded.pdb    Alignment file: C2KJS1_occ.pir

Procheck score ⇒ Ramachandran plot: 91.5% favored    8.5% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur