| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C2KJS1
dbSWEET id: dbswt_1647
Accession: C2KJS1
Uniprot status: Unreviewed
Organism: Leuconostoc mesenteroides
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.
Sequence Information back to top
Sequence length: 104
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C2KJS1|C2KJS1_LEUMC|Unreviewed|Leuconostoc mesenteroides| 104
MNYDNYVPKESRKEVSQERIRFLKLLSKVAVVFCCLMYISYIPQITANLSGNPVSVLQPL
CATVNATLWVTYGWLKTYKDWPVILANIPGVIFGVVTVVTVYVH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: C2KJS1_inward.pdb Alignment file: C2KJS1_inw.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 8.5% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: C2KJS1_outward.pdb Alignment file: C2KJS1_out.pir Procheck score ⇒ Ramachandran plot: 87.7% favored 10.8% allowed 1.5% week .0% disallowed Occluded: Model structure: C2KJS1_occluded.pdb Alignment file: C2KJS1_occ.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 8.5% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA