Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C2ERC8

dbSWEET id: dbswt_1999

Accession:   C2ERC8

Uniprot status:   Unreviewed

Organism:   Lactobacillus vaginalis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   94

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|C2ERC8|C2ERC8_9LACO|Unreviewed|Lactobacillus vaginalis|94
MKRGTRMNESKFISWLGRIASIIAILMYVSYIAQIYNNLHGNYAAPLQPFVAGVNCTLWS
IYAYFKKDRDWPVFWANFPGVFFSFATFLTCFPW

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   17     Model end:   93

Inward Open:

Template:   4X5M.pdb

Model structure:  C2ERC8_inward.pdb    Alignment file: C2ERC8_inw.pir

Procheck score ⇒ Ramachandran plot: 85.1% favored    11.2% allowed    2.2% week    1.5% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C2ERC8_outward.pdb    Alignment file: C2ERC8_out.pir

Procheck score ⇒ Ramachandran plot: 89.6% favored    6.7% allowed    3.0% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C2ERC8_occluded.pdb    Alignment file: C2ERC8_occ.pir

Procheck score ⇒ Ramachandran plot: 86.6% favored    11.9% allowed    1.5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur