| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C2ERC8
dbSWEET id: dbswt_1999
Accession: C2ERC8
Uniprot status: Unreviewed
Organism: Lactobacillus vaginalis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 94
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C2ERC8|C2ERC8_9LACO|Unreviewed|Lactobacillus vaginalis|94
MKRGTRMNESKFISWLGRIASIIAILMYVSYIAQIYNNLHGNYAAPLQPFVAGVNCTLWS
IYAYFKKDRDWPVFWANFPGVFFSFATFLTCFPW
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 17 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: C2ERC8_inward.pdb Alignment file: C2ERC8_inw.pir Procheck score ⇒ Ramachandran plot: 85.1% favored 11.2% allowed 2.2% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: C2ERC8_outward.pdb Alignment file: C2ERC8_out.pir Procheck score ⇒ Ramachandran plot: 89.6% favored 6.7% allowed 3.0% week .7% disallowed Occluded: Model structure: C2ERC8_occluded.pdb Alignment file: C2ERC8_occ.pir Procheck score ⇒ Ramachandran plot: 86.6% favored 11.9% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA