Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C2CXN8

dbSWEET id: dbswt_1998

Accession:   C2CXN8

Uniprot status:   Unreviewed

Organism:   Lactobacillus brevis

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.

Sequence Information back to top


Sequence length:   113

Substrate Binding Site:   ASAS           CVV:   280       CHI:   2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|C2CXN8|C2CXN8_LACBR|Unreviewed|Lactobacillus brevis| 113
MEAIGMQSQLRPTQGQFRNQVQDALHKKRIDEIKLIGDFATIANFIMYVSYIGEIISNLN
GNPISPIQPLFAALNATLWVSYGWLKPKKDWRLIIASFPGVVFGVLAALTAMV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   37     Model end:   113

Inward Open:

Template:   4X5M.pdb

Model structure:  C2CXN8_inward.pdb    Alignment file: C2CXN8_inw.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    10.2% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C2CXN8_outward.pdb    Alignment file: C2CXN8_out.pir

Procheck score ⇒ Ramachandran plot: 85.9% favored    10.9% allowed    1.6% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C2CXN8_occluded.pdb    Alignment file: C2CXN8_occ.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    7.8% allowed    3.1% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur