Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : C0XHY0
dbSWEET id: dbswt_1997
Accession: C0XHY0
Uniprot status: Unreviewed
Organism: Lactobacillus hilgardii
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 108
Substrate Binding Site: ASAS CVV: 280 CHI: 2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C0XHY0|C0XHY0_LACHI|Unreviewed|Lactobacillus hilgardii| 108
MQSQLRPTQGQFRNQVQDALHKKRIDEIKLIGDFATIANFIMYVSYIGEIISNLNGNPIS
PIQPLFAALNATLWVSYGWLKPKKDWRLIIASFPGVVFGVLAALTAMM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 32 Model end: 108 Inward Open: Template: 4X5M.pdb Model structure: C0XHY0_inward.pdb Alignment file: C0XHY0_inw.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 10.2% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: C0XHY0_outward.pdb Alignment file: C0XHY0_out.pir Procheck score ⇒ Ramachandran plot: 85.2% favored 11.7% allowed .8% week 2.3% disallowed Occluded: Model structure: C0XHY0_occluded.pdb Alignment file: C0XHY0_occ.pir Procheck score ⇒ Ramachandran plot: 88.3% favored 7.8% allowed 3.1% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA