| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C0WU91
dbSWEET id: dbswt_1996
Accession: C0WU91
Uniprot status: Unreviewed
Organism: Lactobacillus buchneri
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 104
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C0WU91|C0WU91_LACBU|Unreviewed|Lactobacillus buchneri| 104
MRFDTSKYPEGEKALNPNHVKKIKLLGKIATFTCISMYVSYIPEIIANFSGHPVSPIQPL
VAMVNAILWVGYGWFKTYKDWPVIISNVPGVIFGMITVLTVYIH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 27 Model end: 103 Inward Open: Template: 4X5M.pdb Model structure: C0WU91_inward.pdb Alignment file: C0WU91_inw.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 6.3% allowed 1.6% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: C0WU91_outward.pdb Alignment file: C0WU91_out.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.9% allowed 2.4% week .0% disallowed Occluded: Model structure: C0WU91_occluded.pdb Alignment file: C0WU91_occ.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.9% allowed 1.6% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA