| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C0WLR0
dbSWEET id: dbswt_1995
Accession: C0WLR0
Uniprot status: Unreviewed
Organism: Lactobacillus buchneri
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 108
Substrate Binding Site: ASAS CVV: 280 CHI: 2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|C0WLR0|C0WLR0_LACBU|Unreviewed|Lactobacillus buchneri| 108
MQSQLRPTQGQFRNQVQDALHKKRINEIKLIGDFATIANFIMYVSYIGEIISNLNGNPIS
PIQPLFAALNATLWVSYGWLKPKKDWRLIIASFPGVVFGVLAALTAMM
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 32 Model end: 108 Inward Open: Template: 4X5M.pdb Model structure: C0WLR0_inward.pdb Alignment file: C0WLR0_inw.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 7.8% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: C0WLR0_outward.pdb Alignment file: C0WLR0_out.pir Procheck score ⇒ Ramachandran plot: 85.9% favored 10.9% allowed .8% week 2.3% disallowed Occluded: Model structure: C0WLR0_occluded.pdb Alignment file: C0WLR0_occ.pir Procheck score ⇒ Ramachandran plot: 88.3% favored 7.8% allowed 3.1% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA