Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : C0R5P5

dbSWEET id: dbswt_1646

Accession:   C0R5P5

Uniprot status:   Unreviewed

Organism:   Wolbachia

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rickettsiales ⇒ Anaplasmataceae ⇒ Wolbachieae ⇒ Wolbachia.

Sequence Information back to top


Sequence length:   91

Substrate Binding Site:   SNSN           CVV:   338       CHI:   -8.6

Selectivity Filter:   GCGC           CVV:   268       CHI:   4.2

Fasta sequence:

>tr|C0R5P5|C0R5P5_WOLWR|Unreviewed|Wolbachia|91
MYINIEECFGFIALIASLIGLSPQVYKAYITKVTRDVSMLMLVNYLICSLSWIGYGLYQS
SIFVVLSNIAGLVISIISIIQKCYYDAKPAP

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   84

Inward Open:

Template:   4X5M.pdb

Model structure:  C0R5P5_inward.pdb    Alignment file: C0R5P5_inw.pir

Procheck score ⇒ Ramachandran plot: 92.0% favored    6.5% allowed    1.4% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  C0R5P5_outward.pdb    Alignment file: C0R5P5_out.pir

Procheck score ⇒ Ramachandran plot: 92.8% favored    6.5% allowed    .7% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  C0R5P5_occluded.pdb    Alignment file: C0R5P5_occ.pir

Procheck score ⇒ Ramachandran plot: 94.2% favored    5.8% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur