| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : C0R5P5
dbSWEET id: dbswt_1646
Accession: C0R5P5
Uniprot status: Unreviewed
Organism: Wolbachia
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rickettsiales ⇒ Anaplasmataceae ⇒ Wolbachieae ⇒ Wolbachia.
Sequence Information back to top
Sequence length: 91
Substrate Binding Site: SNSN CVV: 338 CHI: -8.6
Selectivity Filter: GCGC CVV: 268 CHI: 4.2
Fasta sequence:
>tr|C0R5P5|C0R5P5_WOLWR|Unreviewed|Wolbachia|91
MYINIEECFGFIALIASLIGLSPQVYKAYITKVTRDVSMLMLVNYLICSLSWIGYGLYQS
SIFVVLSNIAGLVISIISIIQKCYYDAKPAP
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 7 Model end: 84 Inward Open: Template: 4X5M.pdb Model structure: C0R5P5_inward.pdb Alignment file: C0R5P5_inw.pir Procheck score ⇒ Ramachandran plot: 92.0% favored 6.5% allowed 1.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: C0R5P5_outward.pdb Alignment file: C0R5P5_out.pir Procheck score ⇒ Ramachandran plot: 92.8% favored 6.5% allowed .7% week .0% disallowed Occluded: Model structure: C0R5P5_occluded.pdb Alignment file: C0R5P5_occ.pir Procheck score ⇒ Ramachandran plot: 94.2% favored 5.8% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA