Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B9T3G8

dbSWEET id: dbswt_839

Accession:   B9T3G8

Uniprot status:   Unreviewed

Organism:   Ricinus communis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Acalyphoideae ⇒ Acalypheae ⇒ Ricinus.

Sequence Information back to top


Sequence length:   236

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMN           CVV:   440       CHI:   -1.3

Fasta sequence:

>tr|B9T3G8|B9T3G8_RICCO|Unreviewed|Ricinus_communis|236
MVSASAEFAHAVVGSIGNVISLILYLSPMPTFCHIYNQKDVEEFQCYPYVAAVMNCLLLI
FQGLPMVAPSANSPFIFIINGLGLAVELLYLHIFRYYEKKHKGFSRVVLFLAAEVILLAI
IVTAALLGFHTHSNRNLFVGIFCAVSNVVMYGSPLAIMKKVVLTRSVEYMPHDLSLASFF
NGVFWTVYAVIIFDPLTLASNGLGALLSLAQLLLYAYYSNPKRTAAVMPVQLEPVI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   220

Alignment file: B9T3G8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B9T3G8_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.2% favored    6.7% allowed    1.5% week    1.5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B9T3G8_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.4% favored    4.6% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B9T3G8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    5.7% allowed    1.0% week    1.0% disallowed

Gene Informationback to top


Gene ID:   8278010     Total Exons:   1     Coding Exons:   1

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur