Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : B9T3G8
dbSWEET id: dbswt_839
Accession: B9T3G8
Uniprot status: Unreviewed
Organism: Ricinus communis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Acalyphoideae ⇒ Acalypheae ⇒ Ricinus.
Sequence Information back to top
Sequence length: 236
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|B9T3G8|B9T3G8_RICCO|Unreviewed|Ricinus_communis|236
MVSASAEFAHAVVGSIGNVISLILYLSPMPTFCHIYNQKDVEEFQCYPYVAAVMNCLLLI
FQGLPMVAPSANSPFIFIINGLGLAVELLYLHIFRYYEKKHKGFSRVVLFLAAEVILLAI
IVTAALLGFHTHSNRNLFVGIFCAVSNVVMYGSPLAIMKKVVLTRSVEYMPHDLSLASFF
NGVFWTVYAVIIFDPLTLASNGLGALLSLAQLLLYAYYSNPKRTAAVMPVQLEPVI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 220
Alignment file: B9T3G8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B9T3G8_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.2% favored 6.7% allowed 1.5% week 1.5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B9T3G8_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.4% favored 4.6% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B9T3G8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 5.7% allowed 1.0% week 1.0% disallowed
Gene Informationback to top
Gene ID: 8278010 Total Exons: 1 Coding Exons: 1
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA