Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B9S3W0

dbSWEET id: dbswt_277

Accession:   B9S3W0

Uniprot status:   Unreviewed

Organism:   Ricinus communis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Acalyphoideae ⇒ Acalypheae ⇒ Ricinus.

Sequence Information back to top


Sequence length:   286

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVC           CVV:   369       CHI:   10.1

Fasta sequence:

>tr|B9S3W0|B9S3W0_RICCO|Unreviewed|Ricinus_communis|286
MALNDPRFILAFGILGNIVSFLVYLAPLPTFWRIVKKKSTEGFQSIPYSVALFSAMLTLY
YATLKENAILLITINSIGCLIEGIYLTIYMIYATQTSRVQIHFKLLILFNLGTYLLIVML
ASELTHGTLRVQVVGWICAVFSVCVFAAPLSIMRLVIKTKSVEYMPFSLSFFLTLCAISW
LGYGLAVNDYFIASPNILGFLFGIVQMVLYMIYKNKKNEILPTSTSQELAVSKPETSQDR
ENSNSSSLNQQDLEAAKDDRRENNKAVPEEASERNGYRATCFGISF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   215

Alignment file: B9S3W0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B9S3W0_inward.pdb

Procheck score ⇒ Ramachandran plot: 84.4% favored    8.9% allowed    3.1% week    3.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B9S3W0_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    5.7% allowed    2.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B9S3W0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.8% allowed    .5% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur