Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B9RT75

dbSWEET id: dbswt_495

Accession:   B9RT75

Uniprot status:   Unreviewed

Organism:   Ricinus communis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Acalyphoideae ⇒ Acalypheae ⇒ Ricinus.

Sequence Information back to top


Sequence length:   244

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   MNMN           CVV:   440       CHI:   -3.2

Fasta sequence:

>tr|B9RT75|B9RT75_RICCO|Unreviewed|Ricinus_communis|244
MELSILFVGIIGNVISVLMFLSPVGTFWRIIKNESTEEFESLPYVCTLLNAALWTYYGII
KPGAYLVATVNGFGIVVEIVYVALFLIYAPAKMRAKTAILVALLDVGFLAAAILVTRLAL
KGEVRIDATGFMCAGLNIIMYGSPLAAMKTVVTTKSVEFMPFFLSFFFFLNGGIWTFYAI
LTRDYFLGVPNGTGFCLGITQLVLYAIYKNAKPCKTRVSDHRNGLEEGSQYENLISSSQT
TPGN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   210

Alignment file: B9RT75.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B9RT75_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.9% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B9RT75_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    3.8% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B9RT75_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    7.1% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   8278748     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur