Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B9RIL5

dbSWEET id: dbswt_565

Accession:   B9RIL5

Uniprot status:   Unreviewed

Organism:   Ricinus communis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Acalyphoideae ⇒ Acalypheae ⇒ Ricinus.

Sequence Information back to top


Sequence length:   251

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMA           CVV:   411       CHI:   4

Fasta sequence:

>tr|B9RIL5|B9RIL5_RICCO|Unreviewed|Ricinus_communis|251
MGDRLRLAVGVMGNAASLLLYAAPILTFARVIRKRSIEEFSCVPYIVTLGNCLLYTWYGL
PVVSCRWENLPLVTINGLGIFFEISFILVYFRFAETRGKIKVAITIIPVILYFAATAAIS
SFAFHDHHHRKLFTGSVGLLASVGMYGSPLVVMKQVITTKSVEFMPFYLSFFSFLASSLW
LTYGLLSHDLFIASPNFLGVPFGIIQLVLYFIYRKWGVMEEPKDRDLERDNGEKSKQLKL
AVDENTNGGKC

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   215

Alignment file: B9RIL5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B9RIL5_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.4% favored    6.4% allowed    1.1% week    2.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B9RIL5_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    5.9% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B9RIL5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    8.0% allowed    .5% week    1.6% disallowed

Gene Informationback to top


Gene ID:   8274383     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur