| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B9RFD4
dbSWEET id: dbswt_453
Accession: B9RFD4
Uniprot status: Unreviewed
Organism: Ricinus communis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Acalyphoideae ⇒ Acalypheae ⇒ Ricinus.
Sequence Information back to top
Sequence length: 288
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: VSMN CVV: 398 CHI: 1.8
Fasta sequence:
>tr|B9RFD4|B9RFD4_RICCO|Unreviewed|Ricinus_communis|288
MANLSFIVGILGNIISILVFASPIKTFWIVMKKKSTENYKGVPYITTLLSTSLWTFYGLL
NPDGLLVVTVNGTGVVFQSVYVTLFLIYAPKDKKIKSAKLVALLNVGFVGAVIAVTLLAM
HGHLRLTFVGIVCAALTIGMYAAPLSAMRMVIKTKSVEYMPFLLSFFLFLNGGIWSIYAL
LVKDIYIGVPNATGFVLGSVQLILYAIYKSKSPSTKPQDAIGEGSAHSVKGDIEMDAYSN
DEEASAKNISLDKGISLPVPSVNRQKSLQKVLRTLSLNAKDLQYWAIE
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: B9RFD4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B9RFD4_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 6.0% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B9RFD4_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.3% favored 6.6% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B9RFD4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 4.4% allowed 2.2% week .5% disallowed
Gene Informationback to top
Gene ID: 8287109 Total Exons: 7 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA