Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : B9RAA3
dbSWEET id: dbswt_186
Accession: B9RAA3
Uniprot status: Unreviewed
Organism: Ricinus communis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Acalyphoideae ⇒ Acalypheae ⇒ Ricinus.
Sequence Information back to top
Sequence length: 279
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|B9RAA3|B9RAA3_RICCO|Unreviewed|Ricinus_communis|279
MAFHLTLAFAFGLLGNIISFLVCLAPMPTFYQICKKKTSEGFQSIPYVIALFSATLWLFY
AIFANDATLLITINSFAFFMETAYIAIYLFYAVKKDRLFTTKLVLSLNIFAFGSICVIAM
FLTHGQKRVQLLGWICMVFALCVFVAPLAIVRKVIKTKSVEFMPFSLSFFLTLSAVMWFF
YGFLKKDLYVAVPNILGFMFGVLQMILYLIYRNPKKTGDDDQKANELPNQHSIIDVAKLN
TRVSCCEPNATTVAHSRNDREEQQTMQINREDKDATNTV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 213
Alignment file: B9RAA3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B9RAA3_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.8% favored 6.2% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B9RAA3_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.3% favored 5.6% allowed 1.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B9RAA3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.3% favored 7.2% allowed .5% week 2.1% disallowed
Gene Informationback to top
Gene ID: 8269177 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22