Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B9RAA2

dbSWEET id: dbswt_191

Accession:   B9RAA2

Uniprot status:   Unreviewed

Organism:   Ricinus communis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Acalyphoideae ⇒ Acalypheae ⇒ Ricinus.

Sequence Information back to top


Sequence length:   277

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|B9RAA2|B9RAA2_RICCO|Unreviewed|Ricinus_communis|277
MAYHLSLEFLFGVLANIISSMVCLAPLPTFYQICKKKTSEGFQSVPYVIALFSAMLWLFY
ATFDDNATLLITINSFTFFMEVGYLSVYLFYGTRKDRMLTTKLVLFFNVFGFGMIAILTL
FLTHGRKRVDVLGWICMIFALCVFVAPLGIMRKVIKTKSVEFMPFSLSFFLTLSAVMWFF
YGFLKKDIYVYIPNVLGFFFGIVQMILYLIYRNSKKPVEEPKSQEFSEHIVDVAKLSAVI
CSELKTMVVAKLNDNGNEVVKEETKNTKQEMEASNKV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   213

Alignment file: B9RAA2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B9RAA2_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.2% favored    3.6% allowed    2.1% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B9RAA2_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.7% favored    5.7% allowed    2.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B9RAA2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    5.7% allowed    1.0% week    1.0% disallowed

Gene Informationback to top


Gene ID:   8269176     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur