| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B9RAA2
dbSWEET id: dbswt_191
Accession: B9RAA2
Uniprot status: Unreviewed
Organism: Ricinus communis
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Acalyphoideae ⇒ Acalypheae ⇒ Ricinus.
Sequence Information back to top
Sequence length: 277
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|B9RAA2|B9RAA2_RICCO|Unreviewed|Ricinus_communis|277
MAYHLSLEFLFGVLANIISSMVCLAPLPTFYQICKKKTSEGFQSVPYVIALFSAMLWLFY
ATFDDNATLLITINSFTFFMEVGYLSVYLFYGTRKDRMLTTKLVLFFNVFGFGMIAILTL
FLTHGRKRVDVLGWICMIFALCVFVAPLGIMRKVIKTKSVEFMPFSLSFFLTLSAVMWFF
YGFLKKDIYVYIPNVLGFFFGIVQMILYLIYRNSKKPVEEPKSQEFSEHIVDVAKLSAVI
CSELKTMVVAKLNDNGNEVVKEETKNTKQEMEASNKV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 213
Alignment file: B9RAA2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B9RAA2_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 3.6% allowed 2.1% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B9RAA2_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 5.7% allowed 2.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B9RAA2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 5.7% allowed 1.0% week 1.0% disallowed
Gene Informationback to top
Gene ID: 8269176 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF22