Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B9RAA0

dbSWEET id: dbswt_428

Accession:   B9RAA0

Uniprot status:   Unreviewed

Organism:   Ricinus communis

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Euphorbiaceae ⇒ Acalyphoideae ⇒ Acalypheae ⇒ Ricinus.

Sequence Information back to top


Sequence length:   285

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   MSLS           CVV:   394       CHI:   4.1

Fasta sequence:

>tr|B9RAA0|B9RAA0_RICCO|Unreviewed|Ricinus_communis|285
MTMAEHHPLIFTFGVLGNIISILMFLSPMFTFIRVYKKKSTEGFQSIPYVVALFSCMLWI
YYAMLKSGDYLLLSINSFGCLVQTIYIVLFIFYAEKKAKILTLQLLFLMNFAGFLAIVAL
TRFFAKGSSRLHIVGWFCVAVSAVLFAAPLSVIRLVVRTKSVEFMPFTLSLFLTLSAIMW
LLYGVLLKDLYIALPNIFGLVFGAIQMVLYVIYRDGKKVIELPEKIDMDSPIKTFEVHAA
VVSLPIPDDNYQVNKEDNPNEQRKPNADSTESLNQEQFTVDEVTA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   3     Model end:   215

Alignment file: B9RAA0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B9RAA0_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.1% allowed    .5% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B9RAA0_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.3% favored    4.1% allowed    1.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B9RAA0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    5.2% allowed    1.0% week    .5% disallowed

Gene Informationback to top


Gene ID:   8269174     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur