Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : B9I7C7
dbSWEET id: dbswt_490
Accession: B9I7C7
Uniprot status: Unreviewed
Organism: Populus trichocarpa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Salicaceae ⇒ Saliceae ⇒ Populus.
Sequence Information back to top
Sequence length: 238
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: LNMN CVV: 440 CHI: -1.3
Fasta sequence:
>tr|B9I7C7|B9I7C7_POPTR|Unreviewed|Populus_trichocarpa|238
MLLRTGNIISVLLFLSPVGVFRRILKHRSTEEFESLPYICTLLNSSLWTYYGIIKTGEFL
VATINGFGVVVEIVLLTLFLVFAPPRIRAKTAMLIGILDVGFLAAAILVCQLLLQGDMKI
DIIGFLGAGLNVVMYGSPLAAMKTVVRTKSVEYMPFLLSLFVFLNGGVWTCYAVLKKDWF
LGVANVAGCFLGAAQLILYAIYWKPKSSKNTASKDSEHGSQHEHLLPSSSHFRENNEA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 204
Alignment file: B9I7C7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B9I7C7_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 4.0% allowed 1.1% week 1.7% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B9I7C7_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.4% favored 3.4% allowed 1.7% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B9I7C7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.8% favored 9.0% allowed .6% week .6% disallowed
Gene Informationback to top
Gene ID: 7478934 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA