Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B9I7C1

dbSWEET id: dbswt_450

Accession:   B9I7C1

Uniprot status:   Unreviewed

Organism:   Populus trichocarpa

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Salicaceae ⇒ Saliceae ⇒ Populus.

Sequence Information back to top


Sequence length:   269

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   LSMN           CVV:   417       CHI:   1.4

Fasta sequence:

>tr|B9I7C1|B9I7C1_POPTR|Unreviewed|Populus_trichocarpa|269
MASLSFFVGIMGNIISLLLFVSPIKTFWGVVKKKSTENYKGVPYITTLLSTSLWTFYGLI
KPDILVVSVNGVGAIFQFIYVTLFLIYAPKDTKVTMAKFVAILNVGFLGAVIMVALLAIH
GNLRITFVGILCAALTIGMYAAPLSAMRRVIKTKSVEYMPFLLSFFLFLNGGVWSAYSVL
VKDFYIGVPNVVGFVLGSAQLILYLMYKNKSASAKTMKAIEEDGSVQLVKGSVDILVHRD
KDDEDDGGIDEGNLKNRSLSKGKSLPKPS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   209

Alignment file: B9I7C1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B9I7C1_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    6.0% allowed    2.2% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B9I7C1_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.0% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B9I7C1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    6.6% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur