Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B9I7C0

dbSWEET id: dbswt_451

Accession:   B9I7C0

Uniprot status:   Unreviewed

Organism:   Populus trichocarpa

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Salicaceae ⇒ Saliceae ⇒ Populus.

Sequence Information back to top


Sequence length:   293

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   VSMN           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|B9I7C0|B9I7C0_POPTR|Unreviewed|Populus_trichocarpa|293
MAKISFFIGIVGNIISLLVFTSPIKTFWKVVKRKSTENYKGAPYITTLLSTSLWAFYGLL
KPDILVVTVNGAGAIFQLTYVTLFLMYAPKDKKIKTAKLVAILNAGFLGVVIAITLLAMH
GSLQTTFVGVLCAALTIGMYAAPLSAMKRVMRTKSVQYMPFFLSFFLFLNGGVWSVYAVL
IKDYYIGVPNVVGFVLGSAQLILYIIYRNKSAAMIEEKGPVHIEAKEGVEMPAKGENDEE
AGNLKSRSLAEGKAKSLPKPSVERQHSLQKLTKTLSIGAYELLQHSSWANDAV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   209

Alignment file: B9I7C0.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B9I7C0_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.6% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B9I7C0_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.9% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B9I7C0_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.6% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Gene ID:   7481719     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur