| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B9I542
dbSWEET id: dbswt_574
Accession: B9I542
Uniprot status: Unreviewed
Organism: Populus trichocarpa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Salicaceae ⇒ Saliceae ⇒ Populus.
Sequence Information back to top
Sequence length: 255
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMA CVV: 411 CHI: 4
Fasta sequence:
>tr|B9I542|B9I542_POPTR|Unreviewed|Populus_trichocarpa|255
MGDTLRLAVGVMGNAASMLLFSAPILTFYRIIRKKSTEEFSCVPYIIALLNCLLYTWYGL
PVVSYRWENFPVVTINGLGILLEFSFIFIYFWFTSARGKATIGVQIKVAITVIPVILVFC
ITAAISAFALHDHHHRKIFVGSVALVASVAMYGSPLVVVKKVIMTQSVEYMPFYLSFFSF
LASSFWMAYGLLSHDLFLAAPNLVGSPLGFLQLILYCKYRKTGIMEEPEKWDLERNEEKS
KQLQLVINDSTNDKS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 221
Alignment file: B9I542.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B9I542_inward.pdb
Procheck score ⇒ Ramachandran plot: 88.3% favored 6.6% allowed 4.1% week 1.0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B9I542_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.8% favored 7.7% allowed 1.5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B9I542_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.3% favored 7.7% allowed 1.5% week .5% disallowed
Gene Informationback to top
Gene ID: 7485217 Total Exons: 7 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA