Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B9I542

dbSWEET id: dbswt_574

Accession:   B9I542

Uniprot status:   Unreviewed

Organism:   Populus trichocarpa

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Malpighiales ⇒ Salicaceae ⇒ Saliceae ⇒ Populus.

Sequence Information back to top


Sequence length:   255

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMA           CVV:   411       CHI:   4

Fasta sequence:

>tr|B9I542|B9I542_POPTR|Unreviewed|Populus_trichocarpa|255
MGDTLRLAVGVMGNAASMLLFSAPILTFYRIIRKKSTEEFSCVPYIIALLNCLLYTWYGL
PVVSYRWENFPVVTINGLGILLEFSFIFIYFWFTSARGKATIGVQIKVAITVIPVILVFC
ITAAISAFALHDHHHRKIFVGSVALVASVAMYGSPLVVVKKVIMTQSVEYMPFYLSFFSF
LASSFWMAYGLLSHDLFLAAPNLVGSPLGFLQLILYCKYRKTGIMEEPEKWDLERNEEKS
KQLQLVINDSTNDKS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   221

Alignment file: B9I542.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B9I542_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.3% favored    6.6% allowed    4.1% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B9I542_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    7.7% allowed    1.5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B9I542_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.3% favored    7.7% allowed    1.5% week    .5% disallowed

Gene Informationback to top


Gene ID:   7485217     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur