| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B8A833
dbSWEET id: dbswt_587
Accession: B8A833
Uniprot status: Reviewed
Organism: Oryza sativa
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ BOP clade ⇒ Oryzoideae ⇒ Oryzeae ⇒ Oryzinae ⇒ Oryza.
Sequence Information back to top
Sequence length: 230
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>sp|B8A833|SWT2B_ORYSI|Reviewed|Oryza_sativa|230
MDSLYDISCFAAGLAGNIFALALFLSPVTTFKRILKAKSTERFDGLPYLFSLLNCLICLW
YGLPWVADGRLLVATVNGIGAVFQLAYICLFIFYADSRKTRMKIIGLLVLVVCGFALVSH
ASVFFFDQPLRQQFVGAVSMASLISMFASPLAVMGVVIRSESVEFMPFYLSLSTFLMSAS
FALYGLLLRDFFIYFPNGLGLILGAMQLALYAYYSRKWRGQDSSAPLLLA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 2 Model end: 216
Alignment file: B8A833.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B8A833_inward.pdb
Procheck score ⇒ Ramachandran plot: 96.8% favored 1.6% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B8A833_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.2% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B8A833_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 6.3% allowed 2.1% week .5% disallowed
Gene Ontologyback to top
GO:0005887 - integral component of plasma membrane
GO:0051119 - sugar transmembrane transporter activity
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA