Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B7ZZ87

dbSWEET id: dbswt_605

Accession:   B7ZZ87

Uniprot status:   Unreviewed

Organism:   Zea mays

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Tripsacinae ⇒ Zea.

Sequence Information back to top


Sequence length:   243

Substrate Binding Site:   CNFN           CVV:   413       CHI:   -1.7

Selectivity Filter:   LNMM           CVV:   468       CHI:   4.1

Fasta sequence:

>tr|B7ZZ87|B7ZZ87_MAIZE|Unreviewed|Zea_mays|243
MDWDAPALTSFVADLSFRHLCCYGAGIAGNAFAFVLFVSPLPTFKRIVRNGSTEQFSCTP
YIYSLLNCLICMWYGLPFVSYGVVLVATVNSIGAVFQLAYTAVFIAFADAKQRLKVSALL
AAVFLVFGLIVFVSLALLDHKARQVFVGYLSVASLVCMFASPMSIVNLVIRTKSVEYMPF
YLSLSMFLMSASFVIYGVLLGDGFIYIPNGIGTILGIVQLLLYAYIRKGSSEEAKLPLLI
THT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   15     Model end:   228

Alignment file: B7ZZ87.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B7ZZ87_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    3.7% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B7ZZ87_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    5.8% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B7ZZ87_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    7.4% allowed    .0% week    .0% disallowed

Gene Informationback to top


Gene ID:   100279636     Total Exons:   7     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur