Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B7Q2F5

dbSWEET id: dbswt_1142

Accession:   B7Q2F5

Uniprot status:   Unreviewed

Organism:   Ixodes scapularis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Chelicerata ⇒ Arachnida ⇒ Acari ⇒ Parasitiformes ⇒ Ixodida ⇒ Ixodoidea ⇒ Ixodidae ⇒ Ixodinae ⇒ Ixodes.

Sequence Information back to top


Sequence length:   204

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   SCCV           CVV:   350       CHI:   8.4

Fasta sequence:

>tr|B7Q2F5|B7Q2F5_IXOSC|Unreviewed|Ixodes_scapularis|204
MDTTWCVGQLATAVTFVSFFSGLPLVWRMHRQRSSRGVALLPLVFGCLCTFVWLLYGYAT
NNGTVVFVNKVGTALQLVNVAVHRAYGEVGQDSVVFWGALMFVVAAGAGWKHVSASHLGM
LGSAAVVCCHLSPLPGIPRVLRDRDASSLPFSIIVLSFVVSLLWAVFGLLLRDVNLYAAN
LFGVVVTAFELFLCAVFPGHAKRT

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   199

Alignment file: B7Q2F5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B7Q2F5_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.8% favored    5.2% allowed    1.7% week    2.3% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B7Q2F5_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.6% favored    8.7% allowed    1.2% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B7Q2F5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.6% favored    4.6% allowed    1.7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur