Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B7FJ99

dbSWEET id: dbswt_411

Accession:   B7FJ99

Uniprot status:   Unreviewed

Organism:   Medicago truncatula

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ fabids ⇒ Fabales ⇒ Fabaceae ⇒ Papilionoideae ⇒ Trifolieae ⇒ Medicago.

Sequence Information back to top


Sequence length:   278

Substrate Binding Site:   ANWN           CVV:   422       CHI:   -6.1

Selectivity Filter:   CSVS           CVV:   337       CHI:   5.1

Fasta sequence:

>tr|B7FJ99|B7FJ99_MEDTR|Unreviewed|Medicago_truncatula|278
MVHRDNTAIFVVGILGNIASFFCFIAPVSIFYQVCKKKTTGGFQSAPYVAALFSAMLWIF
YAYIKTGEMLIITINAFGCVIETIYLVIYTTYCSKKARIFTLKLIELFNLGGICLVIILT
HVLAKERTERIELLGWICVVLSTSVFAAPLSVMRVVIRTKSVEFMSFTLSLLLTTSAIIW
LCYGILLKDIFVTLPNFVGITFGTIQMVLYAIYRKNKPVNDQKLPEHKDDMNENQLQVVV
IPLQNVVDIETTMENKEEKKQEETKPSEGNQVQQQKEG

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   215

Alignment file: B7FJ99.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B7FJ99_inward.pdb

Procheck score ⇒ Ramachandran plot: 93.3% favored    5.6% allowed    .5% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B7FJ99_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.8% favored    5.1% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B7FJ99_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    4.6% allowed    2.1% week    1.0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR018179: SWEET10-like. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF22

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur