Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B6T9U6

dbSWEET id: dbswt_287

Accession:   B6T9U6

Uniprot status:   Unreviewed

Organism:   Zea mays

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Tripsacinae ⇒ Zea.

Sequence Information back to top


Sequence length:   307

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSVS           CVV:   356       CHI:   6.8

Fasta sequence:

>tr|B6T9U6|B6T9U6_MAIZE|Unreviewed|Zea_mays|307
MAFLNMEQQTWAFTFGILGNIVSLMVFLSPLPTFYRVYRNKSTEGFQSTPYVVTLFSCML
WILYALLKPGAELLVTINGVGCVVETVYLAMYLVYAPKAARVLAAKMLLGLNVAVFGLVA
LVTMLLSDAGLRVHVLGWICVSVSLSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAV
VWFAYGALKKDVFVAFPNVLGFVFGLAQMALYMAYSRNRKPAAALVILPEQSKEEAAEGK
ASCGGAEVHPIDIAEVHDLQAVVVDVDVEPVTYAAASGMVDGSVGRPRAPEQLVIKPDMV
TVIAAEA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   217

Alignment file: B6T9U6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B6T9U6_inward.pdb

Procheck score ⇒ Ramachandran plot: 95.8% favored    2.6% allowed    1.1% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B6T9U6_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.2% favored    3.2% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B6T9U6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.1% favored    4.8% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Gene ID:   100282648     Total Exons:   5     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur