Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : B6T976
dbSWEET id: dbswt_73
Accession: B6T976
Uniprot status: Unreviewed
Organism: Zea mays
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ Liliopsida ⇒ Poales ⇒ Poaceae ⇒ PACMAD clade ⇒ Panicoideae ⇒ Andropogonodae ⇒ Andropogoneae ⇒ Tripsacinae ⇒ Zea.
Sequence Information back to top
Sequence length: 310
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|B6T976|B6T976_MAIZE|Unreviewed|Zea_mays|310
MAGGLFSMAHPAVTLSGIAGNIISFLVFLAPVATFLQVYRKKSTGGFSSVPYVVALFSSV
LWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLAYAPRRARLRTLAYFFLLDVAAFALV
VAVTLFAVREPHRVKFLGSVCLAFSMAVFVAPLSIIVKVVKTKSVEFLPISLSFCLTLSA
VAWFCYGLFTKDPFVMYPNVGGFFFSCVQMGLYFWYRKPRPAAKNNAVLPTTTDGGNAVQ
VQGQVIELAPNTVAILSVSPIPIVGVHKIEVVEQQHKEAAVAAETRRMAAANPDGAMPEV
IEIVPAAAAV
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 6 Model end: 218
Alignment file: B6T976.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B6T976_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 7.4% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B6T976_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.5% favored 6.3% allowed 1.6% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B6T976_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 8.5% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 100282584 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA