Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B4QL18

dbSWEET id: dbswt_1141

Accession:   B4QL18

Uniprot status:   Unreviewed

Organism:   Drosophila simulans

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila ⇒ Sophophora.

Sequence Information back to top


Sequence length:   228

Substrate Binding Site:   VNWN           CVV:   460       CHI:   -3.7

Selectivity Filter:   TGMV           CVV:   370       CHI:   5

Fasta sequence:

>tr|B4QL18|B4QL18_DROSI|Unreviewed|Drosophila_simulans|228
MEALGDLLAPHSELIAKVAGTITTLQFLSGVVLMNDIRKKGSSDVYPVGPFLFGVVLTIL
SLKLANIMNDAAMINTNLIGLVINFVFLFGFYYYASSASRSKIWKQIGYSSVFLLVITAY
ANFEDPAKIEFRLGMLITGILVWMVGSPLLHLPKIIEKKSTEGMPFPIIFAGNLVALSWT
LYAISIKNTVMVLQNLLLLVLGGIQLSMFAIYPNKPAAKKPKDSKKDK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   2     Model end:   214

Alignment file: B4QL18.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B4QL18_inward.pdb

Procheck score ⇒ Ramachandran plot: 85.5% favored    8.6% allowed    2.7% week    3.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B4QL18_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.8% allowed    1.6% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B4QL18_occluded.pdb

Procheck score ⇒ Ramachandran plot: 87.6% favored    9.7% allowed    2.2% week    .5% disallowed

Gene Informationback to top


Gene ID:   6738145     Total Exons:   3     Coding Exons:   3

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur