| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B4PCF7
dbSWEET id: dbswt_1139
Accession: B4PCF7
Uniprot status: Unreviewed
Organism: Drosophila yakuba
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila ⇒ Sophophora.
Sequence Information back to top
Sequence length: 228
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: QLMV CVV: 467 CHI: 6.4
Fasta sequence:
>tr|B4PCF7|B4PCF7_DROYA|Unreviewed|Drosophila_yakuba|228
MEALGDLLAPHSELIAKVAGTITTLQFLSGVVLMNDIRKKGSSDVYPVGPFLFGVVLTIL
SLKLASIMNDAAMINTNLIGLAINFVFLSGFYYYASSDSRSKIWKQIGYSSVFLLVITAY
ANFEDPAKIEFRLGMLITGLLVWMVGSPLLHLPKIIEKKSTEGMPFPIIFAGNLVAFSWT
LYAISIKNTVMVLQNLLLLVLGGIQLSMFAIYPSKPAAKKPKDSKKDK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: B4PCF7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B4PCF7_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.8% favored 7.6% allowed 1.1% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B4PCF7_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.8% favored 7.1% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B4PCF7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 6.0% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 6534478 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number



Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5