| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B4LH68
dbSWEET id: dbswt_1134
Accession: B4LH68
Uniprot status: Unreviewed
Organism: Drosophila virilis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila.
Sequence Information back to top
Sequence length: 229
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: QLLV CVV: 467 CHI: 8.3
Fasta sequence:
>tr|B4LH68|B4LH68_DROVI|Unreviewed|Drosophila_virilis|229
MDALSDLLAPYSETIGKIAGTITTLQFLSGVALLNDIRKKGSSDVYPVGPFLGGIVLTVL
SLKLGQLMGDQPMINVNIIGFAINTVFMVGFYYYASSENKSKIWIKIGYVSLFLMACIAY
ANFEDPKQIEFRLGMLITSILVWLVGSPLLNLPNIIKKKSTEGMPFPIIFAGQLVATAWT
LYALSIRNHVMVYQNLFLWILGSIQLAMFVLYPSTPAKKPNAKSAKKEK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: B4LH68.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B4LH68_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.0% favored 8.8% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B4LH68_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.5% favored 5.0% allowed .6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B4LH68_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.8% favored 6.6% allowed .6% week .0% disallowed
Gene Informationback to top
Gene ID: 6623502 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number



Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5