Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B4KMT6

dbSWEET id: dbswt_1132

Accession:   B4KMT6

Uniprot status:   Unreviewed

Organism:   Drosophila mojavensis

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila.

Sequence Information back to top


Sequence length:   227

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QSFV           CVV:   427       CHI:   2.7

Fasta sequence:

>tr|B4KMT6|B4KMT6_DROMO|Unreviewed|Drosophila_mojavensis|227
MTLAYDSVLATTAVISTVFQFLSGTVICRKYIQKKSTGESSGVPFICGFLSCSFWLRYGV
LTNEQSIVMVNMIGSTLFLIYTLVYYVFTVNKRAYVKQFGIVLAILIAVIVYTNSLQDDP
QKMIHLTGIVCCIVTVCFFAAPLTSLVHVIRVKNSESLPLPLIATSFFVSLQWLIYGILI
SDSFIQIPNFLGCLLSLLQLGLFVLYPPRSYSYTGQGYKLLEQAVPF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: B4KMT6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B4KMT6_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.0% favored    8.0% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B4KMT6_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    5.9% allowed    1.1% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B4KMT6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.0% favored    6.9% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Gene ID:   6578996     Total Exons:   6     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur