| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B4KMT6
dbSWEET id: dbswt_1132
Accession: B4KMT6
Uniprot status: Unreviewed
Organism: Drosophila mojavensis
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila.
Sequence Information back to top
Sequence length: 227
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|B4KMT6|B4KMT6_DROMO|Unreviewed|Drosophila_mojavensis|227
MTLAYDSVLATTAVISTVFQFLSGTVICRKYIQKKSTGESSGVPFICGFLSCSFWLRYGV
LTNEQSIVMVNMIGSTLFLIYTLVYYVFTVNKRAYVKQFGIVLAILIAVIVYTNSLQDDP
QKMIHLTGIVCCIVTVCFFAAPLTSLVHVIRVKNSESLPLPLIATSFFVSLQWLIYGILI
SDSFIQIPNFLGCLLSLLQLGLFVLYPPRSYSYTGQGYKLLEQAVPF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 208
Alignment file: B4KMT6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B4KMT6_inward.pdb
Procheck score ⇒ Ramachandran plot: 91.0% favored 8.0% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B4KMT6_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 5.9% allowed 1.1% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B4KMT6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.0% favored 6.9% allowed 1.6% week .5% disallowed
Gene Informationback to top
Gene ID: 6578996 Total Exons: 6 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number





Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA