| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B4IZ11
dbSWEET id: dbswt_1129
Accession: B4IZ11
Uniprot status: Unreviewed
Organism: Drosophila grimshawi
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila ⇒ Hawaiian Drosophila.
Sequence Information back to top
Sequence length: 232
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: QLLV CVV: 467 CHI: 8.3
Fasta sequence:
>tr|B4IZ11|B4IZ11_DROGR|Unreviewed|Drosophila_grimshawi|232
MDGISDLLEPYSETIGKIAGTITTLQFLSGIALLNDIRKKQSSDVYPVEPFLGGIVLTVL
SVKLGQVMGDQPMMKVNIIGFAINTVFMVGFYYYASGERKTQIWAKIGYVSLFLMSCIAY
ANFEDPKQVEFRLGMIITGILVWLVGSPLLNIPNVIKNKSTEGMPFPIIFAGQLVVTAWM
FYAFSIRNHVMVWQNLLIFVLGGIQLSMFVLYPNTPVKKQPPSGKKSSKKNN
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 214
Alignment file: B4IZ11.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B4IZ11_inward.pdb
Procheck score ⇒ Ramachandran plot: 86.7% favored 10.6% allowed 1.7% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B4IZ11_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 7.2% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B4IZ11_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.9% favored 7.8% allowed 2.8% week .6% disallowed
Gene Informationback to top
Gene ID: 6556957 Total Exons: 3 Coding Exons: 3
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number



Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5