Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : B4HRI6
dbSWEET id: dbswt_1127
Accession: B4HRI6
Uniprot status: Unreviewed
Organism: Drosophila sechellia
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Brachycera ⇒ Muscomorpha ⇒ Ephydroidea ⇒ Drosophilidae ⇒ Drosophila ⇒ Sophophora.
Sequence Information back to top
Sequence length: 226
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|B4HRI6|B4HRI6_DROSE|Unreviewed|Drosophila_sechellia|226
MSAVAYDSLLSTTAVISTVFQFLSGAMICRKYIQKKSTGDSSGVPFICGFLSCSFWLRYG
VLTNEQSIVLVNIIGSTLFLVYTLIYYVFTVNKRACVKQFGFVLTVLVVVILYTNRLEDQ
RDRMIHVTGIVCCIVTVCFFAAPLASLLHVIRAKNSESLPLPLIATSFVVSLQWLIYGIL
ISDSFIQIPNFLGCILSLLQLGLFVLYPPRSYSGHGYKLVEQAVPF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 209
Alignment file: B4HRI6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B4HRI6_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 6.3% allowed 1.1% week 2.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B4HRI6_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 3.7% allowed 1.1% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B4HRI6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.0% favored 5.3% allowed 2.6% week 2.1% disallowed
Gene Informationback to top
Gene ID: 6608107 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA