Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : B3RTA1
dbSWEET id: dbswt_1123
Accession: B3RTA1
Uniprot status: Unreviewed
Organism: Trichoplax adhaerens
Kingdom: Metazoa
Sequence Information back to top
Sequence length: 217
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LSMV CVV: 426 CHI: 9.1
Fasta sequence:
>tr|B3RTA1|B3RTA1_TRIAD|Unreviewed|Trichoplax_adhaerens|217
MQPSDYFAWMATLSTIGLYLTGIQTCNKIFKNGSSSNVPYFPILACLTSCTLWLKYGMLL
QDKALTIVNVIGVVLESIYAVIYYVHLSNKSSINRMTLYAGAFILSVLAYVKYGISSYDV
ALNLLGIICSLTTIIMYGSPLASALKVIRNNSSESMQLSLCLANALVSFEWGAYGYIIGN
QFVMIPNTIGVVLGVLQLVLFFRYRVESSKTDKQIPI
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 206
Alignment file: B3RTA1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B3RTA1_inward.pdb
Procheck score ⇒ Ramachandran plot: 86.4% favored 10.3% allowed 1.6% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B3RTA1_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.6% favored 4.9% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B3RTA1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 7.1% allowed .0% week .0% disallowed
Gene Informationback to top
Gene ID: 6751866 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0051119 - sugar transmembrane transporter activity
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA