Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B3RTA1

dbSWEET id: dbswt_1123

Accession:   B3RTA1

Uniprot status:   Unreviewed

Organism:   Trichoplax adhaerens

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Placozoa ⇒ Trichoplax.

Sequence Information back to top


Sequence length:   217

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LSMV           CVV:   426       CHI:   9.1

Fasta sequence:

>tr|B3RTA1|B3RTA1_TRIAD|Unreviewed|Trichoplax_adhaerens|217
MQPSDYFAWMATLSTIGLYLTGIQTCNKIFKNGSSSNVPYFPILACLTSCTLWLKYGMLL
QDKALTIVNVIGVVLESIYAVIYYVHLSNKSSINRMTLYAGAFILSVLAYVKYGISSYDV
ALNLLGIICSLTTIIMYGSPLASALKVIRNNSSESMQLSLCLANALVSFEWGAYGYIIGN
QFVMIPNTIGVVLGVLQLVLFFRYRVESSKTDKQIPI

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   206

Alignment file: B3RTA1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B3RTA1_inward.pdb

Procheck score ⇒ Ramachandran plot: 86.4% favored    10.3% allowed    1.6% week    1.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B3RTA1_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.6% favored    4.9% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B3RTA1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    7.1% allowed    .0% week    .0% disallowed

Gene Informationback to top


Gene ID:   6751866     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0051119 - sugar transmembrane transporter activity

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur