Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B3EHG6

dbSWEET id: dbswt_1641

Accession:   B3EHG6

Uniprot status:   Unreviewed

Organism:   Chlorobium limicola

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Chlorobi ⇒ Chlorobia ⇒ Chlorobiales ⇒ Chlorobiaceae ⇒ Chlorobium/Pelodictyon group ⇒ Chlorobium.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   ININ           CVV:   440       CHI:   2

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|B3EHG6|B3EHG6_CHLL2|Unreviewed|Chlorobium limicola|86
MEFASSEAVGFAAGIVTTLSLLPQAVKIMTTRRTRDISLLWAISMNIGILLWLFYGIVKN
DMPMITANSISFVLLFLILIFKLRFR

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   7     Model end:   84

Inward Open:

Template:   4X5M.pdb

Model structure:  B3EHG6_inward.pdb    Alignment file: B3EHG6_inw.pir

Procheck score ⇒ Ramachandran plot: 94.9% favored    4.3% allowed    .7% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  B3EHG6_outward.pdb    Alignment file: B3EHG6_out.pir

Procheck score ⇒ Ramachandran plot: 92.0% favored    8.0% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  B3EHG6_occluded.pdb    Alignment file: B3EHG6_occ.pir

Procheck score ⇒ Ramachandran plot: 97.8% favored    2.2% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur