Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B1ZDC1

dbSWEET id: dbswt_2008

Accession:   B1ZDC1

Uniprot status:   Unreviewed

Organism:   Methylobacterium populi

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Proteobacteria ⇒ Alphaproteobacteria ⇒ Rhizobiales ⇒ Methylobacteriaceae ⇒ Methylobacterium.

Sequence Information back to top


Sequence length:   98

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|B1ZDC1|B1ZDC1_METPB|Unreviewed|Methylobacterium populi|98
MNSNGHAITRSHPTGTSDGFVRWLGWIATVTSVLMFVSYIDQIQLNLSGQKGSIIQPLAT
VVNCGLWTTYGALRRDWPVSFANAPGILLGALALISAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   25     Model end:   99

Inward Open:

Template:   4X5M.pdb

Model structure:  B1ZDC1_inward.pdb    Alignment file: B1ZDC1_inw.pir

Procheck score ⇒ Ramachandran plot: 90.5% favored    7.9% allowed    1.6% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  B1ZDC1_outward.pdb    Alignment file: B1ZDC1_out.pir

Procheck score ⇒ Ramachandran plot: 91.3% favored    6.3% allowed    2.4% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  B1ZDC1_occluded.pdb    Alignment file: B1ZDC1_occ.pir

Procheck score ⇒ Ramachandran plot: 88.9% favored    9.5% allowed    .8% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur