| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B1MYL5
dbSWEET id: dbswt_1640
Accession: B1MYL5
Uniprot status: Unreviewed
Organism: Leuconostoc citreum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Leuconostocaceae ⇒ Leuconostoc.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|B1MYL5|B1MYL5_LEUCK|Unreviewed|Leuconostoc citreum|86
MKAKIHNFVGSIGALIGTFVFIAYIPQIMANLAGDKGQPWQPLVAAFSCLLWVIYGFTNT
PKRDYILITPNLAGVVLGTITFITSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: B1MYL5_inward.pdb Alignment file: B1MYL5_inw.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 7.1% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: B1MYL5_outward.pdb Alignment file: B1MYL5_out.pir Procheck score ⇒ Ramachandran plot: 92.9% favored 6.3% allowed .8% week .0% disallowed Occluded: Model structure: B1MYL5_occluded.pdb Alignment file: B1MYL5_occ.pir Procheck score ⇒ Ramachandran plot: 95.2% favored 4.8% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA