| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : B0X579
dbSWEET id: dbswt_1119
Accession: B0X579
Uniprot status: Unreviewed
Organism: Culex quinquefasciatus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Culicini ⇒ Culex ⇒ Culex.
Sequence Information back to top
Sequence length: 235
Substrate Binding Site: TSWK CVV: 464 CHI: -6.3
Selectivity Filter: QLYA CVV: 446 CHI: 0.8
Fasta sequence:
>tr|B0X579|B0X579_CULQU|Unreviewed|Culex_quinquefasciatus|235
MDSLARGLLPYRDVIGNVAGMLTVAQFLSGCFTCNSIRLKGTSEGFSALQFVLGCGLTTL
QLRYSQMVGAVAMIRTSAYAFAICAVYSVWFAAYTPRGPRRSELWQLVLRTVLVVGGILL
YAGFEQPSKVEYRFGLVVTGLTLGYIGLPLLKLGEVIRRRSTEGLPLPVILASSGASVLW
LLYGIILHNYFIIVQKVIAIGLCTAQLSLFVIYPRSSAPKAAAATKAGGRRAKRD
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 215
Alignment file: B0X579.pir
Inward Open:
Template: 5CTG.pdb
Model structure: B0X579_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.9% favored 8.4% allowed 1.7% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: B0X579_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 6.1% allowed 1.7% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: B0X579_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.1% favored 5.6% allowed 2.2% week 1.1% disallowed
Gene Informationback to top
Gene ID: 6047791 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number




Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5