Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : B0X579

dbSWEET id: dbswt_1119

Accession:   B0X579

Uniprot status:   Unreviewed

Organism:   Culex quinquefasciatus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Culicidae ⇒ Culicinae ⇒ Culicini ⇒ Culex ⇒ Culex.

Sequence Information back to top


Sequence length:   235

Substrate Binding Site:   TSWK           CVV:   464       CHI:   -6.3

Selectivity Filter:   QLYA           CVV:   446       CHI:   0.8

Fasta sequence:

>tr|B0X579|B0X579_CULQU|Unreviewed|Culex_quinquefasciatus|235
MDSLARGLLPYRDVIGNVAGMLTVAQFLSGCFTCNSIRLKGTSEGFSALQFVLGCGLTTL
QLRYSQMVGAVAMIRTSAYAFAICAVYSVWFAAYTPRGPRRSELWQLVLRTVLVVGGILL
YAGFEQPSKVEYRFGLVVTGLTLGYIGLPLLKLGEVIRRRSTEGLPLPVILASSGASVLW
LLYGIILHNYFIIVQKVIAIGLCTAQLSLFVIYPRSSAPKAAAATKAGGRRAKRD

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   215

Alignment file: B0X579.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  B0X579_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    8.4% allowed    1.7% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  B0X579_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.1% allowed    1.7% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  B0X579_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    5.6% allowed    2.2% week    1.1% disallowed

Gene Informationback to top


Gene ID:   6047791     Total Exons:   4     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur